Lineage for d4l4ta1 (4l4t A:1-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938683Domain d4l4ta1: 4l4t A:1-178 [235264]
    Other proteins in same PDB: d4l4ta2, d4l4ta3, d4l4tb_, d4l4tc2, d4l4tc3, d4l4td1, d4l4td2, d4l4te1, d4l4te2, d4l4tf_, d4l4tg1, d4l4tg2, d4l4th1, d4l4th2
    automated match to d1agda2
    complexed with 6fp

Details for d4l4ta1

PDB Entry: 4l4t (more details), 2 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-6-FP
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4l4ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l4ta1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4l4ta1:

Click to download the PDB-style file with coordinates for d4l4ta1.
(The format of our PDB-style files is described here.)

Timeline for d4l4ta1: