Lineage for d4l41c_ (4l41 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898285Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 2898345Protein automated matches [190297] (2 species)
    not a true protein
  7. 2898349Species Human (Homo sapiens) [TaxId:9606] [187395] (19 PDB entries)
  8. 2898393Domain d4l41c_: 4l41 C: [228078]
    Other proteins in same PDB: d4l41a_, d4l41b_
    automated match to d2fyaa_
    complexed with ca, so4

Details for d4l41c_

PDB Entry: 4l41 (more details), 2.7 Å

PDB Description: Human Lactose synthase: A 2:1 complex between human alpha-lactalbumin and human beta1,4-galactosyltransferase
PDB Compounds: (C:) Beta-1,4-galactosyltransferase 1

SCOPe Domain Sequences for d4l41c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l41c_ c.68.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfr
nrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfv
fsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpn
nywgwggedddifnrlvfrgmsisrpnavvgttrmirhsrdkknepnpqrfdriahtket
mlsdglnsltyqvldvqryplytqitvdigtps

SCOPe Domain Coordinates for d4l41c_:

Click to download the PDB-style file with coordinates for d4l41c_.
(The format of our PDB-style files is described here.)

Timeline for d4l41c_: