Lineage for d4l1pa_ (4l1p A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.21: Plus3-like [159042] (1 family) 
automatically mapped to Pfam PF03126Family b.34.21.1: Plus3 [159043] (2 proteins)
Pfam PF03126
Protein automated matches [228071] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [228072] (1 PDB entry) 
Domain d4l1pa_: 4l1p A: [228073]
automated match to d2bzea1
complexed with gol
Details for d4l1pa_
PDB Entry: 4l1p (more details), 2.12 Å
PDB Description: crystal structure of human rtf1 plus3 domain
PDB Compounds: (A:) RNA polymerase-associated protein RTF1 homologSCOPe Domain Sequences for d4l1pa_:
Sequence, based on SEQRES records: (download)
>d4l1pa_ b.34.21.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeitgvve
takvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptld
einkkelsikeal
Sequence, based on observed residues (ATOM records): (download)
>d4l1pa_ b.34.21.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigipvyrvaeitgvvetakvyq
lggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptldeinkke
lsikeal
SCOPe Domain Coordinates for d4l1pa_:
Click to download the PDB-style file with coordinates for d4l1pa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4l1pa_:
- d4l1pa_ first appeared in SCOPe 2.03
- d4l1pa_ appears in SCOPe 2.04
- d4l1pa_ is called d4l1pa1 in SCOPe 2.06
- d4l1pa_ appears in the current release, SCOPe 2.08, called d4l1pa1
View in 3D
