Lineage for d4l0la1 (4l0l A:53-221)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. Protein automated matches [226981] (13 species)
    not a true protein
  7. Species Pseudomonas aeruginosa [TaxId:287] [234430] (7 PDB entries)
  8. Domain d4l0la1: 4l0l A:53-221 [235253]
    Other proteins in same PDB: d4l0la2
    automated match to d4kqoa1
    complexed with pfv

Details for d4l0la1

PDB Entry: 4l0l (more details), 2.1 Å

PDB Description: Crystal structure of P.aeruginosa PBP3 in complex with compound 4
PDB Compounds: (A:) penicillin-binding protein 3

SCOPe Domain Sequences for d4l0la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l0la1 d.175.1.0 (A:53-221) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
vrhiaipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfad
rieqnaerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvdd
rgregielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

SCOPe Domain Coordinates for d4l0la1 are not available.

Timeline for d4l0la1:

Domains from same chain:
(mouse over for more information)
d4l0la2