| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
| Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
| Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
| Species Brucella abortus [TaxId:235] [187418] (2 PDB entries) |
| Domain d4l05a_: 4l05 A: [228497] automated match to d2aqma_ complexed with cu, cu1, gol, so4, zn |
PDB Entry: 4l05 (more details), 1.1 Å
SCOPe Domain Sequences for d4l05a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l05a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Brucella abortus [TaxId: 235]}
esttvkmyealptgpgkevgtvviseapgglhfkvnmekltpgyhgfhvhenpscapgek
dgkivpalaagghydpgnthhhlgpegdghmgdlprlsanadgkvsetvvaphlkklaei
kqrslmvhvggdnysdkpeplggggarfacgvie
Timeline for d4l05a_: