Lineage for d4kyua_ (4kyu A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.0: automated matches [191323] (1 protein)
not a true familyProtein automated matches [190123] (96 species)
not a true protein
Species Bacillus subtilis [TaxId:224308] [256925] (1 PDB entry) 
Domain d4kyua_: 4kyu A: [256926]
automated match to d2dyka_
complexed with gdp, k, mg, na, nh4
Details for d4kyua_
PDB Entry: 4kyu (more details), 1.7 Å
PDB Description: crystal structure of n-terminal g-domain of enga from bacillus subtilis
PDB Compounds: (A:) GTPase DerSCOPe Domain Sequences for d4kyua_:
Sequence, based on SEQRES records: (download)
>d4kyua_ c.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
gkpvvaivgrpnvgkstifnriagerisivedtpgvtrdriyssaewlnydfnlidtggi
digdepflaqirqqaeiamdeadviifmvngregvtaadeevakilyrtkkpvvlavnkl
dntemraniydfyslgfgepypisgthglglgdlldavaehf
Sequence, based on observed residues (ATOM records): (download)
>d4kyua_ c.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
gkpvvaivgrpnvgkstifnriagerirdriyssaewlnydfnlidtggidigdepflaq
irqqaeiamdeadviifmvngregvtaadeevakilyrtkkpvvlavnkldntemraniy
dfyslgfgepypisgthglglgdlldavaehf
SCOPe Domain Coordinates for d4kyua_:
Click to download the PDB-style file with coordinates for d4kyua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4kyua_:
- d4kyua_ first appeared in SCOPe 2.04
- d4kyua_ appears in SCOPe 2.06
- d4kyua_ appears in the current release, SCOPe 2.08
View in 3D
