Lineage for d4kwib_ (4kwi B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.0: automated matches [191313] (1 protein)
not a true familyProtein automated matches [190069] (203 species)
not a true protein
Species Streptomyces cyanogenus [TaxId:80860] [235237] (3 PDB entries) 
Domain d4kwib_: 4kwi B: [235239]
automated match to d1hxha_
complexed with 1tj, nap, peg
Details for d4kwib_
PDB Entry: 4kwi (more details), 2 Å
PDB Description: the crystal structure of angucycline c-6 ketoreductase lanv with bound nadp and 11-deoxy-6-oxylandomycinone
PDB Compounds: (B:) Reductase homologSCOPe Domain Sequences for d4kwib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kwib_ c.2.1.0 (B:) automated matches {Streptomyces cyanogenus [TaxId: 80860]}
hhrsgnltgktalvtgasrgigraiaeklgyagalvavhyatgadaaaevaesiekdggr
aftvkaelgvpgdvdvlfeglerglkertgatdldilvnnagvmamgapeevtpemfdrm
mavnakapffivqralsvmpdggriinvssgltrvaspdqvtygmskgaleqialhfsrh
lgsrritvnsvapgstdngsalfqipevretlsqlstfgevaepaaiadvvaflasedar
witgafidasggtllg
SCOPe Domain Coordinates for d4kwib_:
Click to download the PDB-style file with coordinates for d4kwib_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4kwib_:
- d4kwib_ first appeared in SCOPe 2.03
- d4kwib_ appears in SCOPe 2.04
- d4kwib_ is called d4kwib1 in SCOPe 2.06
- d4kwib_ appears in the current release, SCOPe 2.08, called d4kwib1
View in 3D
