Lineage for d4ku1a1 (4ku1 A:237-341)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295895Species Homo sapiens [TaxId:9606] [230172] (40 PDB entries)
  8. 1295922Domain d4ku1a1: 4ku1 A:237-341 [237062]
    automated match to d1igtb3
    complexed with pg4

Details for d4ku1a1

PDB Entry: 4ku1 (more details), 1.9 Å

PDB Description: role of the hinge and c-gamma-2/c-gamma-3 interface in immunoglobin g1 fc domain motions: implications for fc engineering
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4ku1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ku1a1 b.1.1.0 (A:237-341) automated matches {Homo sapiens [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

SCOPe Domain Coordinates for d4ku1a1:

Click to download the PDB-style file with coordinates for d4ku1a1.
(The format of our PDB-style files is described here.)

Timeline for d4ku1a1:

1295922
d4ku1a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4ku1a2