Lineage for d4kt0d_ (4kt0 D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238092Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 2238093Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 2238094Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 2238098Protein automated matches [236562] (3 species)
    not a true protein
  7. 2238105Species Synechocystis sp. [TaxId:1148] [236566] (1 PDB entry)
  8. 2238106Domain d4kt0d_: 4kt0 D: [236685]
    Other proteins in same PDB: d4kt0a_, d4kt0b_, d4kt0c_, d4kt0e_, d4kt0f_, d4kt0j_
    automated match to d1jb0d_
    complexed with bcr, cl, cl0, cla, lhg, lmg, lmu, pqn, sf4

Details for d4kt0d_

PDB Entry: 4kt0 (more details), 2.8 Å

PDB Description: Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803
PDB Compounds: (D:) Photosystem I subunit II

SCOPe Domain Sequences for d4kt0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kt0d_ d.187.1.1 (D:) automated matches {Synechocystis sp. [TaxId: 1148]}
elsgqppkfggstggllskanreekyaitwtsaseqvfemptggaaimnegenllylark
eqclalgtqlrtkfkpkiqdykiyrvypsgevqylhpadgvfpekvnegreaqgtktrri
gqnpepvtikfsgkapye

SCOPe Domain Coordinates for d4kt0d_:

Click to download the PDB-style file with coordinates for d4kt0d_.
(The format of our PDB-style files is described here.)

Timeline for d4kt0d_: