Class b: All beta proteins [48724] (176 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
Protein automated matches [190692] (11 species) not a true protein |
Species Influenza a virus [TaxId:385580] [228660] (8 PDB entries) |
Domain d4ks3a_: 4ks3 A: [228662] automated match to d2aepa1 complexed with 1sl, ca |
PDB Entry: 4ks3 (more details), 2.6 Å
SCOPe Domain Sequences for d4ks3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ks3a_ b.68.1.0 (A:) automated matches {Influenza a virus [TaxId: 385580]} tymnnteaicdvkgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd khsngtvkdrspfrtlmsvkvgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska vavihyggvptdvinswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr iigqadisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip sdtprgedaqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw tqtskeqvrkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss ssivmcgvdyeiadwswhdgailpfdid
Timeline for d4ks3a_: