Lineage for d4krpb_ (4krp B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758317Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries)
  8. 1758471Domain d4krpb_: 4krp B: [224464]
    Other proteins in same PDB: d4krpc1, d4krpc2
    automated match to d4jvpa_
    complexed with nag

Details for d4krpb_

PDB Entry: 4krp (more details), 2.82 Å

PDB Description: nanobody/vhh domain 9g8 in complex with the extracellular region of egfr
PDB Compounds: (B:) Nanobody/VHH domain 9G8

SCOPe Domain Sequences for d4krpb_:

Sequence, based on SEQRES records: (download)

>d4krpb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlvesggglvqaggslrlscaasgrtfssyamgwfrqapgkerefvvainwssgstyy
adsvkgrftisrdnakntmylqmnslkpedtavyycaagyqinsgnynfkdyeydywgqg
tqvt

Sequence, based on observed residues (ATOM records): (download)

>d4krpb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlvesgggllscaasgrtfssyamgwfrqapgkerefvvainwssgstyyadsvkgrf
tisrdnakntmylqmnslkpedtavyycaagyqinsgnynfkdyeydywgqgtqvt

SCOPe Domain Coordinates for d4krpb_:

Click to download the PDB-style file with coordinates for d4krpb_.
(The format of our PDB-style files is described here.)

Timeline for d4krpb_: