Lineage for d4kqxb2 (4kqx B:194-342)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721939Species Slackia exigua [TaxId:649764] [226701] (2 PDB entries)
  8. 2721943Domain d4kqxb2: 4kqx B:194-342 [224453]
    Other proteins in same PDB: d4kqxa1, d4kqxb1, d4kqxb3
    automated match to d1np3a1
    complexed with hio, his, mg, nad; mutant

Details for d4kqxb2

PDB Entry: 4kqx (more details), 1.8 Å

PDB Description: Mutant Slackia exigua KARI DDV in complex with NAD and an inhibitor
PDB Compounds: (B:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4kqxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kqxb2 a.100.1.0 (B:194-342) automated matches {Slackia exigua [TaxId: 649764]}
faeeteedlfgeqavlcgglvelvkagfetlteagyppelayfecyhemkmivdlmyesg
ihfmnysisntaeygeyyagpkvineqsreamkeilkriqdgsfaqefvddcnnghkrll
eqreainthpiettgaqirsmfswikked

SCOPe Domain Coordinates for d4kqxb2:

Click to download the PDB-style file with coordinates for d4kqxb2.
(The format of our PDB-style files is described here.)

Timeline for d4kqxb2: