![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
![]() | Protein automated matches [226867] (22 species) not a true protein |
![]() | Species Francisella tularensis [TaxId:376619] [226591] (4 PDB entries) |
![]() | Domain d4kqvb_: 4kqv B: [236038] Other proteins in same PDB: d4kqva2 automated match to d4hxza1 protein/DNA complex; complexed with doo, iod |
PDB Entry: 4kqv (more details), 2.38 Å
SCOPe Domain Sequences for d4kqvb_:
Sequence, based on SEQRES records: (download)
>d4kqvb_ d.122.1.0 (B:) automated matches {Francisella tularensis [TaxId: 376619]} sievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsieva ddgrgmpvdihpehkmsgielimtklhsggkfsnknythsgglhgvgvsvvnalstrlea eikrdgnvyhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknll eakailckaltikysneikkekltwhfetg
>d4kqvb_ d.122.1.0 (B:) automated matches {Francisella tularensis [TaxId: 376619]} sievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsieva ddgrgmpvdihpehkmsgielimtklhsggkvgvsvvnalstrleaeikrdgnvyhivfe dgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknlleakailckaltiky sneikkekltwhfetg
Timeline for d4kqvb_: