Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily) helix-swapped dimer of beta(4)-alpha motifs |
Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) |
Family d.18.1.0: automated matches [191638] (1 protein) not a true family |
Protein automated matches [191174] (3 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [228960] (1 PDB entry) |
Domain d4kopa_: 4kop A: [228962] automated match to d3n1ha_ complexed with mpo |
PDB Entry: 4kop (more details), 1.75 Å
SCOPe Domain Sequences for d4kopa_:
Sequence, based on SEQRES records: (download)
>d4kopa_ d.18.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rlfapysifkgkaalsvepvlpsfteidsgnlridrrgslmmtfmpaigerkydwekkqk falsptevgslismgskdsseffhdpsmkssnagqvrkslsvkphadgsgyfislsvnns ilktndyfvvpvtkaefavmktafsfalphimgwnrltghle
>d4kopa_ d.18.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rlfapysifkgkaalsvepvlpsfteidsgnlridrrgslmmtfmpaigerkydwekkqk falsptevgslismgskdsseffhdpqvrkslsvkphadgsgyfislsvnnsilktndyf vvpvtkaefavmktafsfalphimgwnrltghle
Timeline for d4kopa_: