Lineage for d4kl6b_ (4kl6 B:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
complex fold made of five beta-hairpin units and a b-ribbon arcSuperfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families) 
duplication: contains two intertwined structural repeats
Family b.86.1.0: automated matches [254252] (1 protein)
not a true familyProtein automated matches [254576] (3 species)
not a true protein
Species Nostoc punctiforme [TaxId:63737] [255340] (3 PDB entries) 
Domain d4kl6b_: 4kl6 B: [253315]
automated match to d4o1ra_
Details for d4kl6b_
PDB Entry: 4kl6 (more details), 2.2 Å
PDB Description: crystal structure of dimeric form of npudnae intein
PDB Compounds: (B:) DNA polymerase III, alpha subunit, Nucleic acid binding, OB-fold, tRNA/helicase-type chimeric constructSCOPe Domain Sequences for d4kl6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kl6b_ b.86.1.0 (B:) automated matches {Nostoc punctiforme [TaxId: 63737]}
galsyeteiltveygllpigkivekriectvysvdnngniytqpvaqwhdrgeqevfeyc
ledgsliratkdhkfmvdgqmlpideifereldlmrnpgikiatrkylgkqnvydigver
dhnfalkngfiasna
SCOPe Domain Coordinates for d4kl6b_:
Click to download the PDB-style file with coordinates for d4kl6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4kl6b_:
- d4kl6b_ first appeared in SCOPe 2.04
- d4kl6b_ is called d4kl6b1 in SCOPe 2.06
- d4kl6b_ appears in the current release, SCOPe 2.08, called d4kl6b1
View in 3D
