Lineage for d4kf3a_ (4kf3 A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
common core: 2 helices, disulfide-linked, and a calcium-binding loopSuperfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
automatically mapped to Pfam PF00068
Protein automated matches [190139] (27 species)
not a true protein
Species Bothrops moojeni [TaxId:98334] [188126] (13 PDB entries) 
Domain d4kf3a_: 4kf3 A: [224281]
automated match to d1xxsa_
complexed with ipa, pe4
Details for d4kf3a_
PDB Entry: 4kf3 (more details), 1.92 Å
PDB Description: Crystal Structure of Myotoxin II (MjTX-II), a myotoxic Lys49-phospholipase A2 from Bothrops moojeni.
PDB Compounds: (A:) Basic phospholipase A2 homolog 2SCOPe Domain Sequences for d4kf3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kf3a_ a.133.1.2 (A:) automated matches {Bothrops moojeni [TaxId: 98334]}
slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpfckkad
pc
SCOPe Domain Coordinates for d4kf3a_:
Click to download the PDB-style file with coordinates for d4kf3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4kf3a_:
- d4kf3a_ first appeared in SCOPe 2.03
- d4kf3a_ appears in SCOPe 2.07
View in 3D
