Lineage for d4kdne_ (4kdn E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531229Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1531245Species Influenza A virus, different strains [TaxId:11320] [49825] (99 PDB entries)
  8. 1531332Domain d4kdne_: 4kdn E: [227551]
    Other proteins in same PDB: d4kdnb_, d4kdnd_, d4kdnf_
    automated match to d4kpsa_
    complexed with nag, sia

Details for d4kdne_

PDB Entry: 4kdn (more details), 2.48 Å

PDB Description: crystal structure of the hemagglutinin of ferret-transmissible h5n1 virus in complex with avian receptor analog lsta
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4kdne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdne_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
sswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgih
hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndai
nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
gecpkyvksnrlvlaiglrnsp

SCOPe Domain Coordinates for d4kdne_:

Click to download the PDB-style file with coordinates for d4kdne_.
(The format of our PDB-style files is described here.)

Timeline for d4kdne_: