Lineage for d4kafb_ (4kaf B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins) 
Protein automated matches [190880] (4 species)
not a true proteinSpecies Rhodococcus sp. [TaxId:1831] [189207] (7 PDB entries) 
Domain d4kafb_: 4kaf B: [202842]
automated match to d4kafa_
complexed with edo, na, peg, scn
Details for d4kafb_
PDB Entry: 4kaf (more details), 1.5 Å
PDB Description: Crystal Structure of Haloalkane dehalogenase HaloTag7 at the resolution 1.5A, Northeast Structural Genomics Consortium (NESG) Target OR151
PDB Compounds: (B:) haloalkane dehalogenaseSCOPe Domain Sequences for d4kafb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kafb_ c.69.1.8 (B:) automated matches {Rhodococcus sp. [TaxId: 1831]}
shmaeigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapt
hrciapdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakr
nperikgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpmgvv
rpltevemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkll
fwgtpgvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstleisg
SCOPe Domain Coordinates for d4kafb_:
Click to download the PDB-style file with coordinates for d4kafb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4kafb_:
- d4kafb_ first appeared in SCOPe 2.03
- d4kafb_ appears in SCOPe 2.04
- d4kafb_ is called d4kafb1 in SCOPe 2.06
- d4kafb_ appears in the current release, SCOPe 2.08, called d4kafb1
View in 3D
