Lineage for d4ka6a2 (4ka6 A:444-748)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275305Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1275306Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1275763Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
    duplication: tandem repeat of two CCP-like domains
  6. 1275866Protein automated matches [227103] (2 species)
    not a true protein
  7. 1275867Species Burkholderia pseudomallei [TaxId:272560] [237825] (2 PDB entries)
  8. 1275873Domain d4ka6a2: 4ka6 A:444-748 [237828]
    automated match to d3n3qb2
    complexed with cl, hem, mpd, na, niz

Details for d4ka6a2

PDB Entry: 4ka6 (more details), 1.7 Å

PDB Description: structure of d141a variant of b. pseudomallei katg complexed with inh
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d4ka6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ka6a2 a.93.1.3 (A:444-748) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
llwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgganga
rirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaa
knaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaql
ltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadad
vfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnld
rfdla

SCOPe Domain Coordinates for d4ka6a2:

Click to download the PDB-style file with coordinates for d4ka6a2.
(The format of our PDB-style files is described here.)

Timeline for d4ka6a2:

1275873
d4ka6a2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4ka6a1