SCOPe 2.05: Domain d4k8va2: 4k8v A:394-507

Lineage for d4k8va2 (4k8v A:394-507)

Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds)
Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
core: 5-helical bundle; up-and-down; right-handed twist
Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
this domain follows the catalytic nucleotidyltransferase domain
Family a.160.1.6: cGAMP synthase, cGAS C-terminal domain [254175] (1 protein)
PubMed 23647843; structurally very similar to hOAS1 (a.160.1.2)
Protein cGAMP synthase, cGAS C-terminal domain [254395] (2 species)
Species Mouse (Mus musculus) [TaxId:10090] [254831] (1 PDB entry)
Domain d4k8va2: 4k8v A:394-507 [253166]
Other proteins in same PDB: d4k8va1, d4k8vb1, d4k8vc1, d4k8vd1
complexed with zn

Details for d4k8va2

PDB Description: Structure of cyclic GMP-AMP Synthase (cGAS)

PDB Compounds: (A:) Cyclic GMP-AMP synthase

SCOPe Domain Sequences for d4k8va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k8va2 a.160.1.6 (A:394-507) cGAMP synthase, cGAS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
rkeclklmkylleqlkkefqeldafcsyhvktaifhmwtqdpqdsqwdprnlsscfdkll
affleclrtekldhyfipkfnlfsqelidrkskeflskkieyernngfpifdkl

SCOPe Domain Coordinates for d4k8va2:

Click to download the PDB-style file with coordinates for d4k8va2.
(The format of our PDB-style files is described here.)

Timeline for d4k8va2: