Lineage for d4k7ra_ (4k7r A:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.5: Outer membrane efflux proteins (OEP) [56953] (1 superfamily)
    subunit fold contains tandem repeat of alpha-beta hairpin-alpha(2) motif
    trimeric fold contains barrel (n=12, S=18) formed by beta-hairpins, two from each subunit, and a bundle of helices with a channel running through it
  4. Superfamily f.5.1: Outer membrane efflux proteins (OEP) [56954] (2 families) (S)
  5. Family f.5.1.0: automated matches [227266] (1 protein)
    not a true family
  6. Protein automated matches [227059] (5 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [226068] (3 PDB entries)
  8. Domain d4k7ra_: 4k7r A: [228350]
    automated match to d3pika_
    complexed with 3pk

Details for d4k7ra_

PDB Entry: 4k7r (more details), 2.09 Å

PDB Description: Crystal structures of CusC review conformational changes accompanying folding and transmembrane channel formation
PDB Compounds: (A:) Cation efflux system protein cusC

SCOPe Domain Sequences for d4k7ra_:

Sequence, based on SEQRES records: (download)

>d4k7ra_ f.5.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
cslapdyqrpampvpqqfslsqnglvnaadnyqnagwrtffvdnqvktlisealvnnrdl
rmatlkvqearaqyrltdadrypqlngegsgswsgnlkgntattrefstglnasfdldff
grlknmseaerqnylateeaqravhillvsnvaqsyfnqqlayaqlqiaeetlrnyqqsy
afvekqlltgssnvlaleqargviestrsdiakrqgelaqannalqlllgsygklpqaqt
vnsdslqsvklpaglssqillqrpdimeaehalmaananigaaraaffpsisltsgista
ssdlsslfnassgmwnfipkieipifnagrnqanldiaeirqqqsvvnyeqkiqnafkev
adalalrqslndqisaqqrylaslqitlqraralyqhgavsylevldaerslfatrqtll
dlnyarqvneislytalggg

Sequence, based on observed residues (ATOM records): (download)

>d4k7ra_ f.5.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
cslapdyqrpampvpqqfslyqnagwrtffvdnqvktlisealvnnrdlrmatlkvqear
aqyrltdadrypqlngegsgswsgnlkgntattrefstglnasfdldffgrlknmseaer
qnylateeaqravhillvsnvaqsyfnqqlayaqlqiaeetlrnyqqsyafvekqlltgs
snvlaleqargviestrsdiakrqgelaqannalqlllgsygklpqaqtvnsdslqsvkl
paglssqillqrpdimeaehalmaananigaaraaffpsisltsgistassdlsslfnas
sgmwnfipkieipifnagrnqanldiaeirqqqsvvnyeqkiqnafkevadalalrqsln
dqisaqqrylaslqitlqraralyqhgavsylevldaerslfatrqtlldlnyarqvnei
slytalggg

SCOPe Domain Coordinates for d4k7ra_ are not available.

Timeline for d4k7ra_: