Lineage for d4k7gd_ (4k7g D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898719Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 1898720Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 1898822Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 1898823Protein automated matches [190491] (13 species)
    not a true protein
  7. 1898827Species Agrobacterium vitis [TaxId:311402] [226728] (2 PDB entries)
  8. 1898831Domain d4k7gd_: 4k7g D: [240401]
    automated match to d4k7gb_
    complexed with act, cit, pyc

Details for d4k7gd_

PDB Entry: 4k7g (more details), 2 Å

PDB Description: Crystal structure of a 3-hydroxyproline dehydratse from agrobacterium vitis, target efi-506470, with bound pyrrole 2-carboxylate, ordered active site
PDB Compounds: (D:) 3-hydroxyproline dehydratse

SCOPe Domain Sequences for d4k7gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k7gd_ d.21.1.0 (D:) automated matches {Agrobacterium vitis [TaxId: 311402]}
lgtenlyfqsmrtnkvihvigvhaegevgdvivggvspppgdtlweqsrfiasdetlrnf
vlneprggvfrhvnllvppkdpraqmgfiimepadtppmsgsnsicvstaildsgiismq
eplthmvleapggvievtaecangkaerinvlnvasfvtrlaaaleveglgtltvdtayg
gdsfvivdaiglgfslkpdearelaelgmkitaaaneqlgfvhpcnadwnhisfcqmttp
itrengiltgksavairpgkidrsptgtgcsarlavmhargeigigetyigrsiidsefk
chidslteigglsairpvisgrawitgvsqlmldptdpwpsgyqlsdtwpai

SCOPe Domain Coordinates for d4k7gd_:

Click to download the PDB-style file with coordinates for d4k7gd_.
(The format of our PDB-style files is described here.)

Timeline for d4k7gd_: