Lineage for d4k7gb_ (4k7g B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939535Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2939536Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2939665Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2939666Protein automated matches [190491] (18 species)
    not a true protein
  7. 2939675Species Agrobacterium vitis [TaxId:311402] [226728] (2 PDB entries)
  8. 2939678Domain d4k7gb_: 4k7g B: [235110]
    Other proteins in same PDB: d4k7gd2
    automated match to d4lb0b_
    complexed with act, cit, pyc

Details for d4k7gb_

PDB Entry: 4k7g (more details), 2 Å

PDB Description: Crystal structure of a 3-hydroxyproline dehydratse from agrobacterium vitis, target efi-506470, with bound pyrrole 2-carboxylate, ordered active site
PDB Compounds: (B:) 3-hydroxyproline dehydratse

SCOPe Domain Sequences for d4k7gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k7gb_ d.21.1.0 (B:) automated matches {Agrobacterium vitis [TaxId: 311402]}
kvihvigvhaegevgdvivggvspppgdtlweqsrfiasdetlrnfvlneprggvfrhvn
llvppkdpraqmgfiimepadtppmsgsnsicvstaildsgiismqeplthmvleapggv
ievtaecangkaerinvlnvasfvtrlaaaleveglgtltvdtayggdsfvivdaiglgf
slkpdearelaelgmkitaaaneqlgfvhpcnadwnhisfcqmttpitrengiltgksav
airpgkidrsptgtgcsarlavmhargeigigetyigrsiidsefkchidslteigglsa
irpvisgrawitgvsqlmldptdpwpsgyqlsdtwpai

SCOPe Domain Coordinates for d4k7gb_:

Click to download the PDB-style file with coordinates for d4k7gb_.
(The format of our PDB-style files is described here.)

Timeline for d4k7gb_: