Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
Protein automated matches [190491] (18 species) not a true protein |
Species Agrobacterium vitis [TaxId:311402] [226728] (2 PDB entries) |
Domain d4k7gb_: 4k7g B: [235110] Other proteins in same PDB: d4k7gd2 automated match to d4lb0b_ complexed with act, cit, pyc |
PDB Entry: 4k7g (more details), 2 Å
SCOPe Domain Sequences for d4k7gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k7gb_ d.21.1.0 (B:) automated matches {Agrobacterium vitis [TaxId: 311402]} kvihvigvhaegevgdvivggvspppgdtlweqsrfiasdetlrnfvlneprggvfrhvn llvppkdpraqmgfiimepadtppmsgsnsicvstaildsgiismqeplthmvleapggv ievtaecangkaerinvlnvasfvtrlaaaleveglgtltvdtayggdsfvivdaiglgf slkpdearelaelgmkitaaaneqlgfvhpcnadwnhisfcqmttpitrengiltgksav airpgkidrsptgtgcsarlavmhargeigigetyigrsiidsefkchidslteigglsa irpvisgrawitgvsqlmldptdpwpsgyqlsdtwpai
Timeline for d4k7gb_: