Lineage for d4k6lg_ (4k6l G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606665Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2606666Protein automated matches [191197] (12 species)
    not a true protein
  7. 2606852Species Salmonella enterica [TaxId:90370] [226726] (1 PDB entry)
  8. 2606853Domain d4k6lg_: 4k6l G: [224185]
    Other proteins in same PDB: d4k6lf_
    automated match to d1prta_
    complexed with gol

Details for d4k6lg_

PDB Entry: 4k6l (more details), 2.39 Å

PDB Description: Structure of Typhoid Toxin
PDB Compounds: (G:) Putative pertussis-like toxin subunit

SCOPe Domain Sequences for d4k6lg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k6lg_ d.166.1.0 (G:) automated matches {Salmonella enterica [TaxId: 90370]}
vdfvyrvdstppdvifrdgfsllgynrnfqqfisgrscsggssdsryiattssvnqtyai
arayysrstfkgnlyryqiradnnfysllpsityletqgghfnayektmmrlqreyvstl
silpeniqkavalvydsatglvkdgvstmnasylglsttsnpgvipflpepqtytqqrid
afgplisscfsigsvchshrgqradvynmsfydarpvielilsk

SCOPe Domain Coordinates for d4k6lg_:

Click to download the PDB-style file with coordinates for d4k6lg_.
(The format of our PDB-style files is described here.)

Timeline for d4k6lg_: