Lineage for d4k6cb_ (4k6c B:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.0: automated matches [191313] (1 protein)
not a true familyProtein automated matches [190069] (181 species)
not a true protein
Species Burkholderia cenocepacia [TaxId:216591] [193149] (5 PDB entries) 
Domain d4k6cb_: 4k6c B: [193150]
automated match to d3ezla_
complexed with cl, edo
Details for d4k6cb_
PDB Entry: 4k6c (more details), 1.85 Å
PDB Description: X-ray crystal structure of a putative Acetoacyl-CoA reductase from Burkholderia cenocepacia
PDB Compounds: (B:) Acetoacetyl-CoA reductaseSCOPe Domain Sequences for d4k6cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k6cb_ c.2.1.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
kriavvtggmgglgeavsirlndaghrvvvtyspnntgadrwltemhaagrefhaypvdv
adhdscqqciekivrdvgpvdilvnnagitrdmtlrkldkvnwdavirtnldsvfnmtkp
vcdgmvergwgrivnissvngskgsvgqtnyaaakagmhgftkslaleiarkgvtvntvs
pgylatkmvtaipqdildtkilpqipagrlgkpeevaalvaylcseeagfvtgsniaing
gqhmh
SCOPe Domain Coordinates for d4k6cb_:
Click to download the PDB-style file with coordinates for d4k6cb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4k6cb_:
- d4k6cb_ first appeared in SCOPe 2.02
- d4k6cb_ appears in SCOPe 2.03
- d4k6cb_ appears in SCOPe 2.05
- d4k6cb_ appears in the current release, SCOPe 2.08
View in 3D
