Lineage for d4k4qa_ (4k4q A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily)
barrel, closed; n=6, S=10, complex topologySuperfamily b.50.1: Acid proteases [50630] (4 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
dimer of identical mono-domain chains, each containing (6,10) barrelProtein Human immunodeficiency virus type 1 protease [50632] (9 species) 
Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries) 
Domain d4k4qa_: 4k4q A: [227955]
automated match to d3ekya_
complexed with 06b, 3tl, bme, dms, no3
Details for d4k4qa_
PDB Entry: 4k4q (more details), 1.8 Å
PDB Description: TL-3 inhibited Trp6Ala HIV Protease with 3-bromo-2,6-dimethoxybenzoic acid bound in flap site
PDB Compounds: (A:) hiv-1 proteaseSCOPe Domain Sequences for d4k4qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k4qa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlakrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf
SCOPe Domain Coordinates for d4k4qa_:
Click to download the PDB-style file with coordinates for d4k4qa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4k4qa_:
- d4k4qa_ first appeared in SCOPe 2.03
- d4k4qa_ appears in SCOPe 2.06
- d4k4qa_ appears in the current release, SCOPe 2.08
View in 3D
