Lineage for d4k3gb_ (4k3g B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355288Domain d4k3gb_: 4k3g B: [235081]
    automated match to d4k3hc_
    complexed with man

Details for d4k3gb_

PDB Entry: 4k3g (more details), 1.93 Å

PDB Description: immunoglobulin lambda variable domain l5(l89s) fluorogen activating protein
PDB Compounds: (B:) Immunoglobulin lambda variable domain L5(L89S)

SCOPe Domain Sequences for d4k3gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k3gb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qavvtqepsvtvspggtviltcgsstgavtsghyanwfqqkpgqapralifetdkkyswt
pgrfsgsllgakaaltisdaqpedeaeyycslsdvdgylfgggtqltvl

SCOPe Domain Coordinates for d4k3gb_:

Click to download the PDB-style file with coordinates for d4k3gb_.
(The format of our PDB-style files is described here.)

Timeline for d4k3gb_: