Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:272560] [226749] (1 PDB entry) |
Domain d4k2da_: 4k2d A: [224103] automated match to d3hz8a_ complexed with gol |
PDB Entry: 4k2d (more details), 1.9 Å
SCOPe Domain Sequences for d4k2da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k2da_ c.47.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 272560]} spsapvagkdfevmkspqpvsapagkvevieffwygcphcyefeptieawvkkqgdkiaf krvpvafrddfvphsklfyalaalgvsekvtpavfnaihkeknylltpqaqadflatqgv dkkkfldaynsfsvqgqvkqsaellknynidgvptivvqgkyktgpaytnslegtaqvld flvkqvqdkkl
Timeline for d4k2da_: