Lineage for d4k2da_ (4k2d A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879329Species Burkholderia pseudomallei [TaxId:272560] [226749] (1 PDB entry)
  8. 2879330Domain d4k2da_: 4k2d A: [224103]
    automated match to d3hz8a_
    complexed with gol

Details for d4k2da_

PDB Entry: 4k2d (more details), 1.9 Å

PDB Description: Crystal structure of Burkholderia Pseudomallei DsbA
PDB Compounds: (A:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d4k2da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k2da_ c.47.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
spsapvagkdfevmkspqpvsapagkvevieffwygcphcyefeptieawvkkqgdkiaf
krvpvafrddfvphsklfyalaalgvsekvtpavfnaihkeknylltpqaqadflatqgv
dkkkfldaynsfsvqgqvkqsaellknynidgvptivvqgkyktgpaytnslegtaqvld
flvkqvqdkkl

SCOPe Domain Coordinates for d4k2da_:

Click to download the PDB-style file with coordinates for d4k2da_.
(The format of our PDB-style files is described here.)

Timeline for d4k2da_: