Lineage for d4k2aa_ (4k2a A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152792Species Bradyrhizobium elkanii [TaxId:29448] [256834] (1 PDB entry)
  8. 2152793Domain d4k2aa_: 4k2a A: [256836]
    Other proteins in same PDB: d4k2ac2
    automated match to d3sk0a_
    complexed with act, cl

Details for d4k2aa_

PDB Entry: 4k2a (more details), 2.2 Å

PDB Description: Crystal structure of haloalkane dehalogenase DbeA from Bradyrhizobium elkani USDA94
PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d4k2aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k2aa_ c.69.1.0 (A:) automated matches {Bradyrhizobium elkanii [TaxId: 29448]}
dislhhravlgstmayretgrsdaphvlflhgnptssyiwrnimplvapvghciapdlig
ygqsgkpdisyrffdqadyldalidelgiasaylvaqdwgtalafhlaarrpqlvrglaf
mefirpmrdwsdfhqhdaaretfrkfrtpgvgeamildnnafvervlpgsilrtlseeem
aayrapfatresrmptlmlprelpiagepadvtqaltaahaalaastypkllfvgspgal
vspafaaefaktlkhcaviqlgagghylqedhpeaigrsvagwiagieaasaqrha

SCOPe Domain Coordinates for d4k2aa_:

Click to download the PDB-style file with coordinates for d4k2aa_.
(The format of our PDB-style files is described here.)

Timeline for d4k2aa_: