Lineage for d4jzba_ (4jzb A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.128: Terpenoid synthases [48575] (1 superfamily)
multihelical; core: 8 helices (C-J) are arranged in 2 parallel layersSuperfamily a.128.1: Terpenoid synthases [48576] (6 families) 
duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-JFamily a.128.1.0: automated matches [196408] (1 protein)
not a true familyProtein automated matches [196409] (30 species)
not a true protein
Species Leishmania major [TaxId:5664] [236738] (3 PDB entries) 
Domain d4jzba_: 4jzb A: [236739]
automated match to d3id0a_
complexed with ca, ipe, na, p2h
Details for d4jzba_
PDB Entry: 4jzb (more details), 1.9 Å
PDB Description: crystal structure of leshmaniasis major farnesyl diphosphate synthase in complex with 1-(2-hydroxy-2,2-diphosphonoethyl)-3- phenylpyridinium, ipp and ca2+
PDB Compounds: (A:) farnesyl pyrophosphate synthaseSCOPe Domain Sequences for d4jzba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jzba_ a.128.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]}
mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
vmgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygst
dpaavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykr
qk
SCOPe Domain Coordinates for d4jzba_:
Click to download the PDB-style file with coordinates for d4jzba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4jzba_:
- d4jzba_ first appeared in SCOPe 2.03
- d4jzba_ appears in SCOPe 2.04
- d4jzba_ is called d4jzba1 in SCOPe 2.06
- d4jzba_ appears in the current release, SCOPe 2.08, called d4jzba1
View in 3D
