Class a: All alpha proteins [46456] (286 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein Cytochrome P450-CAM [48266] (1 species) |
Species Pseudomonas putida [TaxId:303] [48267] (108 PDB entries) Uniprot P00183 |
Domain d4jwua_: 4jwu A: [197413] Other proteins in same PDB: d4jwuc_, d4jwud_ automated match to d1t87a_ complexed with 1n0, ca, fes, hem |
PDB Entry: 4jwu (more details), 2.2 Å
SCOPe Domain Sequences for d4jwua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jwua_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsngghwiatrgq lireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen riqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg ldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgriltsdyefhg vqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclgqhlarreiiv tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d4jwua_: