Lineage for d4jwla_ (4jwl A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745754Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 1745790Family a.118.3.0: automated matches [191673] (1 protein)
    not a true family
  6. 1745791Protein automated matches [191283] (2 species)
    not a true protein
  7. 1745795Species Human (Homo sapiens) [TaxId:9606] [189904] (8 PDB entries)
  8. 1745802Domain d4jwla_: 4jwl A: [228461]
    automated match to d1ku1a_
    complexed with hrc

Details for d4jwla_

PDB Entry: 4jwl (more details), 1.95 Å

PDB Description: Complexe of ARNO Sec7 domain with the protein-protein interaction inhibitor N-(4-hydroxy-2,6-dimethylphenyl)benzenesulfonamide at pH7.5
PDB Compounds: (A:) Cytohesin-2

SCOPe Domain Sequences for d4jwla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jwla_ a.118.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigd
ylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycl
cnpgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeellrn
lydsirnepfkipe

SCOPe Domain Coordinates for d4jwla_:

Click to download the PDB-style file with coordinates for d4jwla_.
(The format of our PDB-style files is described here.)

Timeline for d4jwla_: