Lineage for d4jvwb_ (4jvw B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2369909Domain d4jvwb_: 4jvw B: [235060]
    automated match to d1cqka_

Details for d4jvwb_

PDB Entry: 4jvw (more details), 2 Å

PDB Description: IgM C4-domain from mouse
PDB Compounds: (B:) ig mu chain c region secreted form

SCOPe Domain Sequences for d4jvwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jvwb_ b.1.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hkhppavyllppareqlnlresatvtclvkgfspadisvqwlqrgqllpqekyvtsapmp
epgapgfyfthsiltvteeewnsgetytcvvghealphlvtertvdkst

SCOPe Domain Coordinates for d4jvwb_:

Click to download the PDB-style file with coordinates for d4jvwb_.
(The format of our PDB-style files is described here.)

Timeline for d4jvwb_: