Lineage for d4jv4a1 (4jv4 A:107-244)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) 
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
Pfam PF00027
Protein Regulatory subunit of Protein kinase A [51213] (2 species)
duplication: consists of two similar domains
Species Cow (Bos taurus) [TaxId:9913] [51214] (5 PDB entries)
Uniprot P00514 109-376
Domain d4jv4a1: 4jv4 A:107-244 [227951]
automated match to d1rl3a1
complexed with 1or
Details for d4jv4a1
PDB Entry: 4jv4 (more details), 2.95 Å
PDB Description: Crystal Structure of RIalpha(91-379) bound to HE33, a N6 di-propyl substituted cAMP analog
PDB Compounds: (A:) cAMP-dependent protein kinase type I-alpha regulatory subunitSCOPe Domain Sequences for d4jv4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jv4a1 b.82.3.2 (A:107-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]}
daasyvrkvipkdyktmaalakaieknvlfshlddnersdifdamfpvsfiagetviqqg
degdnfyvidqgemdvyvnnewatsvgeggsfgelaliygtpraatvkaktnvklwgidr
dsyrrilmgstlrkrkmy
SCOPe Domain Coordinates for d4jv4a1:
Click to download the PDB-style file with coordinates for d4jv4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4jv4a1:
- d4jv4a1 first appeared in SCOPe 2.03
- d4jv4a1 appears in SCOPe 2.07
View in 3D
