Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries) |
Domain d4jibd_: 4jib D: [266484] Other proteins in same PDB: d4jiba2 automated match to d4d09c_ complexed with 1l6, mg, zn |
PDB Entry: 4jib (more details), 1.72 Å
SCOPe Domain Sequences for d4jibd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jibd_ a.211.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlar fclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhr gtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlm rdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrk iaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpka aelyervasnrehwtkvshkftirglpsnnsldfl
Timeline for d4jibd_:
View in 3D Domains from other chains: (mouse over for more information) d4jiba1, d4jiba2, d4jibb_, d4jibc_ |