Lineage for d4jh2a_ (4jh2 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.0: automated matches [191344] (1 protein)
not a true familyProtein automated matches [190239] (26 species)
not a true protein
Species Bacillus cereus [TaxId:222523] [228045] (9 PDB entries) 
Domain d4jh2a_: 4jh2 A: [228047]
automated match to d4jd1b_
complexed with fmt, mg, so4, zn
Details for d4jh2a_
PDB Entry: 4jh2 (more details), 1.27 Å
PDB Description: Crystal Structure of FosB from Bacillus cereus with Zinc and Sulfate at 1.27 A Resolution
PDB Compounds: (A:) Metallothiol transferase FosBSCOPe Domain Sequences for d4jh2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jh2a_ d.32.1.0 (A:) automated matches {Bacillus cereus [TaxId: 222523]}
mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei
yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt
lqdrlnyyredkphmtfy
SCOPe Domain Coordinates for d4jh2a_:
Click to download the PDB-style file with coordinates for d4jh2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4jh2a_:
- d4jh2a_ first appeared in SCOPe 2.03
- d4jh2a_ appears in SCOPe 2.07
View in 3D
