Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Bacillus cereus [TaxId:222523] [228045] (9 PDB entries) |
Domain d4jh2a_: 4jh2 A: [228047] automated match to d4jd1b_ complexed with fmt, mg, so4, zn |
PDB Entry: 4jh2 (more details), 1.27 Å
SCOPe Domain Sequences for d4jh2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jh2a_ d.32.1.0 (A:) automated matches {Bacillus cereus [TaxId: 222523]} mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt lqdrlnyyredkphmtfy
Timeline for d4jh2a_: