Lineage for d4jgfb_ (4jgf B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776437Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 1776438Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 1776560Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 1776561Protein automated matches [191109] (10 species)
    not a true protein
  7. 1776609Species Human (Homo sapiens) [TaxId:9606] [230909] (9 PDB entries)
  8. 1776620Domain d4jgfb_: 4jgf B: [234987]
    automated match to d1bd7a_
    mutant

Details for d4jgfb_

PDB Entry: 4jgf (more details), 2.5 Å

PDB Description: Crystal Structure of the Cataract-Causing P23T gamma D-Crystallin Mutant
PDB Compounds: (B:) Gamma-crystallin D

SCOPe Domain Sequences for d4jgfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jgfb_ b.11.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhtnlqpylsrcnsarvdsgcwmlyeqpnysglqyflrrg
dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvi

SCOPe Domain Coordinates for d4jgfb_:

Click to download the PDB-style file with coordinates for d4jgfb_.
(The format of our PDB-style files is described here.)

Timeline for d4jgfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4jgfa_