Lineage for d4jg1l2 (4jg1 L:108-214)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein automated matches [190374] (15 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1239 PDB entries)
  8. Domain d4jg1l2: 4jg1 L:108-214 [223805]
    Other proteins in same PDB: d4jg1h_, d4jg1l1
    automated match to d1rhha2
    complexed with ppi

Details for d4jg1l2

PDB Entry: 4jg1 (more details), 1.55 Å

PDB Description: structure of phosphoserine/threonine (pstab) scaffold bound to pthr peptide
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4jg1l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jg1l2 b.1.1.2 (L:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d4jg1l2 are not available.

Timeline for d4jg1l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jg1l1
View in 3D
Domains from other chains:
(mouse over for more information)
d4jg1h_