Lineage for d4jfzl2 (4jfz L:108-214)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein automated matches [190374] (14 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) 
Domain d4jfzl2: 4jfz L:108-214 [223801]
Other proteins in same PDB: d4jfzl1
automated match to d1rhha2
complexed with ppi
Details for d4jfzl2
PDB Entry: 4jfz (more details), 1.75 Å
PDB Description: structure of phosphoserine (psab) scaffold bound to pser peptide
PDB Compounds: (L:) Fab light chainSCOPe Domain Sequences for d4jfzl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jfzl2 b.1.1.2 (L:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
SCOPe Domain Coordinates for d4jfzl2:
Click to download the PDB-style file with coordinates for d4jfzl2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4jfzl2:
- d4jfzl2 first appeared in SCOPe 2.03
- d4jfzl2 appears in SCOPe 2.04
- d4jfzl2 appears in SCOPe 2.06
- d4jfzl2 appears in the current release, SCOPe 2.08
View in 3D
