![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily) beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432 |
![]() | Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) ![]() |
![]() | Family d.35.1.0: automated matches [196913] (1 protein) not a true family |
![]() | Protein automated matches [196914] (3 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:632] [196915] (3 PDB entries) |
![]() | Domain d4jeta_: 4jet A: [196916] automated match to d1dkha_ complexed with cl, hem |
PDB Entry: 4jet (more details), 2.2 Å
SCOPe Domain Sequences for d4jeta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jeta_ d.35.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]} sttiqynsnyadysissylrewannfgdidqapaetkdrgsfsgsstlfsgtqyaigssh snpegmiaegdlkysfmpqhtfhgqidtlqfgkdlatnaggpsagkhlekiditfneldl sgefdsgksmtenhqgdmhksvrglmkgnpdpmlevmkakginvdtafkdlsiasqypd
Timeline for d4jeta_: