Lineage for d4jera_ (4jer A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1645743Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 1645744Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) (S)
  5. 1645762Family d.35.1.0: automated matches [196913] (1 protein)
    not a true family
  6. 1645763Protein automated matches [196914] (2 species)
    not a true protein
  7. 1645767Species Yersinia pestis [TaxId:632] [196915] (3 PDB entries)
  8. 1645768Domain d4jera_: 4jer A: [223777]
    automated match to d4jeta_
    complexed with na

Details for d4jera_

PDB Entry: 4jer (more details), 1.1 Å

PDB Description: 1.1a resolution apo structure of the hemophore hasa from yersinia pestis (tetragonal form)
PDB Compounds: (A:) hemophore hasa

SCOPe Domain Sequences for d4jera_:

Sequence, based on SEQRES records: (download)

>d4jera_ d.35.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
sttiqynsnyadysissylrewannfgdidqapaetkdrgsfsgsstlfsgtqyaigssh
snpegmiaegdlkysfmpqhtfhgqidtlqfgkdlatnaggpsagkhlekiditfneldl
sgefdsgksmtenhqgdmhksvrglmkgnpdpmlevmkakginvdtafkdlsiasqypds
gym

Sequence, based on observed residues (ATOM records): (download)

>d4jera_ d.35.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
sttiqynsnyadysissylrewannfgdidqapaetkdrgsfsgssfsgtqyaigsshsn
pegmiaegdlkysfmpqhtfhgqidtlqfgkdlatnaggpsagkhlekiditfneldlsg
efdsgksmtenhqgdmhksvrglmkgnpdpmlevmkakginvdtafkdlsiasqypdsgy
m

SCOPe Domain Coordinates for d4jera_:

Click to download the PDB-style file with coordinates for d4jera_.
(The format of our PDB-style files is described here.)

Timeline for d4jera_: