Lineage for d4jdyc_ (4jdy C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827424Family c.1.2.6: PdxS-like [141755] (2 proteins)
    Pfam PF01680; SOR/SNZ
  6. 2827433Protein automated matches [193117] (4 species)
    not a true protein
  7. 2827453Species Mycobacterium tuberculosis [TaxId:1773] [193118] (1 PDB entry)
  8. 2827456Domain d4jdyc_: 4jdy C: [193119]
    automated match to d1znna1
    complexed with gol

Details for d4jdyc_

PDB Entry: 4jdy (more details), 1.8 Å

PDB Description: crystal structure of rv2606c
PDB Compounds: (C:) Pyridoxal biosynthesis lyase pdxS

SCOPe Domain Sequences for d4jdyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jdyc_ c.1.2.6 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tarvkrgmaemlkggvimdvvtpeqariaegagavavmalervpadiraqggvsrmsdpd
miegiiaavtipvmakvrighfveaqilqtlgvdyidesevltpadyahhidkwnftvpf
vcgatnlgealrrisegaamirskgeagtgdvsnatthmraiggeirrltsmsedelfva
akelqapyelvaevaragklpvtlftaggiatpadaammmqlgaegvfvgsgifksgape
hraaaivkattffddpdvlakvsr

SCOPe Domain Coordinates for d4jdyc_:

Click to download the PDB-style file with coordinates for d4jdyc_.
(The format of our PDB-style files is described here.)

Timeline for d4jdyc_: