Lineage for d4jbla_ (4jbl A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1874686Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1874687Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1874993Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 1874994Protein automated matches [190215] (23 species)
    not a true protein
  7. 1875009Species Entamoeba histolytica [TaxId:294381] [225437] (5 PDB entries)
  8. 1875014Domain d4jbla_: 4jbl A: [229420]
    automated match to d3bm5a_
    complexed with met, so4

Details for d4jbla_

PDB Entry: 4jbl (more details), 2 Å

PDB Description: Crystal structure of O-Acetyl Serine Sulfhydrylase from Entamoeba histolytica in complex with Methionine
PDB Compounds: (A:) Cysteine synthase

SCOPe Domain Sequences for d4jbla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jbla_ c.79.1.0 (A:) automated matches {Entamoeba histolytica [TaxId: 294381]}
meqisissprkriyhniletiggtplvelhgvtehprikkgtrilvkleyfnpmssvkdr
vgfnivyqaikdgrlkpgmeiiestsgntgialcqagavfgyrvniampstmsverqmim
kafgaeliltegkkgmpgaieevnkmikenpgkyfvanqfgnpdntaahhytaneiwedt
dgevdivvsavgtsgtvigvaeklkekkkgikiiavepeesavlegkakgphgiqgigag
fipdiykkefvdeiipiktqdawkmaravvkydgimcgmssgaailaglkeaekpenegk
tiviivpscgerylstdlykikdegtkiqildsllnehh

SCOPe Domain Coordinates for d4jbla_:

Click to download the PDB-style file with coordinates for d4jbla_.
(The format of our PDB-style files is described here.)

Timeline for d4jbla_: