Lineage for d4j8ta_ (4j8t A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2181455Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2182081Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)
  6. 2182096Protein Uncharacterized protein PA3332 [159977] (1 species)
  7. 2182097Species Pseudomonas aeruginosa [TaxId:287] [159978] (2 PDB entries)
    Uniprot Q9HYR3 1-129
  8. 2182099Domain d4j8ta_: 4j8t A: [234937]
    automated match to d1z1sa1
    complexed with dog

Details for d4j8ta_

PDB Entry: 4j8t (more details), 2.05 Å

PDB Description: engineered digoxigenin binder dig10.2
PDB Compounds: (A:) Engineered Digoxigenin binder protein DIG10.2

SCOPe Domain Sequences for d4j8ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j8ta_ d.17.4.10 (A:) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]}
mnakeivvhalrllengdargwcdlfhpegvleypypppgyktrfegretiwahmrlfpe
ymtirftdvqfyetadpdlaigefhgdgvhtvsggklaadyisvlrtrdgqillyrlffn
plrvlepl

SCOPe Domain Coordinates for d4j8ta_:

Click to download the PDB-style file with coordinates for d4j8ta_.
(The format of our PDB-style files is described here.)

Timeline for d4j8ta_: