Lineage for d4j88a_ (4j88 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. Protein Green fluorescent protein, GFP [54513] (6 species)
  7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (282 PDB entries)
    Uniprot P42212
  8. Domain d4j88a_: 4j88 A: [223619]
    automated match to d3ztfa_
    complexed with edo, so4, trs

Details for d4j88a_

PDB Entry: 4j88 (more details), 2.08 Å

PDB Description: Dark-state structure of sfGFP containing the unnatural amino acid p-azido-phenylalanine at residue 66
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d4j88a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j88a_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
ttlxvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnri
elkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhyq
qntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagith

SCOPe Domain Coordinates for d4j88a_ are not available.

Timeline for d4j88a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4j88b_