Lineage for d4j6vb_ (4j6v B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
multihelicalSuperfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) 
duplication: contains two structural repeats
Family a.86.1.0: automated matches [254307] (1 protein)
not a true familyProtein automated matches [254708] (4 species)
not a true protein
Species Bacillus megaterium [TaxId:1404] [255981] (21 PDB entries) 
Domain d4j6vb_: 4j6v B: [252832]
automated match to d2ahka_
complexed with cu; mutant
Details for d4j6vb_
PDB Entry: 4j6v (more details), 1.9 Å
PDB Description: Crystal Structure of Tyrosinase from Bacillus megaterium N205D mutant
PDB Compounds: (B:) tyrosinaseSCOPe Domain Sequences for d4j6vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j6vb_ a.86.1.0 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlhdrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel
SCOPe Domain Coordinates for d4j6vb_:
Click to download the PDB-style file with coordinates for d4j6vb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4j6vb_:
- d4j6vb_ first appeared in SCOPe 2.04
- d4j6vb_ appears in SCOPe 2.07
View in 3D
