Lineage for d4j5ga_ (4j5g A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530963Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2530964Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2530965Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2531160Protein automated matches [190834] (3 species)
    not a true protein
  7. 2531169Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries)
  8. 2531175Domain d4j5ga_: 4j5g A: [256789]
    automated match to d1lnia_
    complexed with cac, gol, so4; mutant

Details for d4j5ga_

PDB Entry: 4j5g (more details), 1.31 Å

PDB Description: crystal structure analysis of streptomyces aureofaciens ribonuclease sa t95a mutant
PDB Compounds: (A:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d4j5ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j5ga_ d.1.1.2 (A:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqac

SCOPe Domain Coordinates for d4j5ga_:

Click to download the PDB-style file with coordinates for d4j5ga_.
(The format of our PDB-style files is described here.)

Timeline for d4j5ga_: