Lineage for d4j1xa1 (4j1x A:6-76)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709414Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 2709427Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. 2709428Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
    Uniprot Q56185 6-76
  8. 2709455Domain d4j1xa1: 4j1x A:6-76 [234923]
    Other proteins in same PDB: d4j1xa2, d4j1xb2, d4j1xc2
    automated match to d1zz6a1
    complexed with 1jj, fe2, gol

Details for d4j1xa1

PDB Entry: 4j1x (more details), 2.8 Å

PDB Description: Crystal Structure of Fe(II)-HppE with alternative substrate (S)-1-HPP
PDB Compounds: (A:) epoxidase

SCOPe Domain Sequences for d4j1xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j1xa1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn

SCOPe Domain Coordinates for d4j1xa1:

Click to download the PDB-style file with coordinates for d4j1xa1.
(The format of our PDB-style files is described here.)

Timeline for d4j1xa1:

2709455
d4j1xa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4j1xa2