Lineage for d4iyjb_ (4iyj B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. Protein automated matches [191059] (16 species)
    not a true protein
  7. Species Bacteroides uniformis [TaxId:411479] [226611] (1 PDB entry)
  8. Domain d4iyjb_: 4iyj B: [223480]
    automated match to d1yzfa1
    complexed with cl, gol, unl

Details for d4iyjb_

PDB Entry: 4iyj (more details), 1.37 Å

PDB Description: crystal structure of a putative acylhydrolase (bacuni_03406) from bacteroides uniformis atcc 8492 at 1.37 a resolution
PDB Compounds: (B:) GDSL-like protein

SCOPe Domain Sequences for d4iyjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iyjb_ c.23.10.0 (B:) automated matches {Bacteroides uniformis [TaxId: 411479]}
qkqdwgnlkryaeankelvrkgkqkdrvvfmgnsitegwvandaaffedngyvgrgiggq
tsshfllrfredviklapalvvinagtndiaenagayneeytfgnivsmvelarankikv
iltsvlpaaafgwnpsvkdapqkimqlnarirkyaqenkipyvdyysemvegdnkalnss
ytrdgvhptlegykvmealikkaidkvl

SCOPe Domain Coordinates for d4iyjb_ are not available.

Timeline for d4iyjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4iyja_